For Science...From Science.

Catalog Peptide
ABCDEFGHIJKLMNOPQRSTUVWXYZ

A selection
ProductSequenceMore Info
TFFYGGSRGKRNNFKTEEY More
Biotin-Ahx-RRRRRRRRR More
5-TAMRA-RRRRRRRRR More
5-FAM-RRRRRRRRR More
RRRRRRRRR More
Ac-EKFKNGMLHGDKVSFFCKNKEKKCSYTED More
LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF More
KFRRQRPRLSHKGPMPF More
Ste-QRPRLSHKGPMPF More
(Pyr)RPRLSYKGPMPF More
(Pyr)RPRLYHKGPMPF More
(Pyr)RPRLVHKGPMPF More
(Pyr)RPRFSHKGPMPF More
(Pyr)RPRLTHKGPMPF More
(Pyr)RPRLSHKGPMTF More
(Pyr)RPRLSHKSPMPF More
(Pyr)RPRLSRKGPMPF More
(Pyr)RPRLSPKGPMPF More
(Pyr)RPRLSHKGPNPF More
(Pyr)RPRLSHKGPMPL More
Home Up Next Down Page£º1/9 Total 165 Page
ngago